SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_063756148.1.37966 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_063756148.1.37966
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.41e-30
Family Cofilin-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_063756148.1.37966
Sequence length 134
Comment hypothetical protein [Streptomyces sp. NRRL B-24720]; AA=GCF_000721715.1; RF=na; TAX=1476876; STAX=1476876; NAME=Streptomyces sp. NRRL B-24720; strain=NRRL B-24720; AL=Contig; RT=Major
Sequence
MSGGIPVEDSCIEAFHELKSKRHVNTVIYRLSDNLETVILDFKGNLTHDELLQALPAAET
RFVVYDLVFATADGARKEKTVLISWCPEAAEVEQRNAHSTSRNPLRGLLDGVQAYVQATD
LSDLEYEELVSRTS
Download sequence
Identical sequences WP_063756148.1.37966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]