SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_065998350.1.26601 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_065998350.1.26601
Domain Number 1 Region: 42-84
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000025
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 2 Region: 141-181
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000043
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 3 Region: 93-132
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000347
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_065998350.1.26601
Sequence length 182
Comment hypothetical protein [Ensifer shofinae]; AA=GCF_001704765.1; RF=na; TAX=1850094; STAX=1850094; NAME=Ensifer shofinae; strain=CCBAU 251167; AL=Contig; RT=Major
Sequence
MSLLRLLISRSSASILMVIGFLSACTVVVDEPRPGPAPIRSPQICTMEFAPVCGERGSRL
RTFPNACNARADGFRVLHRGECRPDFRPPVEQACTREYAPVCGERGRQRRTFPNACEARA
DGFRVIGSGECRRNDDPAPPQQFCTREYAPVCGQRGGRLRTFPNACEAGAAGFRIVHGGE
CG
Download sequence
Identical sequences WP_065998350.1.26601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]