SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_066795008.1.88009 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_066795008.1.88009
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily SRP19 1.57e-22
Family SRP19 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_066795008.1.88009
Sequence length 100
Comment hypothetical protein [Caldivirga sp. MU80]; AA=GCF_001663375.1; RF=na; TAX=1650354; STAX=1650354; NAME=Caldivirga sp. MU80; strain=MU80; AL=Contig; RT=Major
Sequence
MSKKDYWVVWRVNIDSTISRSDGRVVPRQLAVEKPTLDELANAASKLGFRYEVHPEKRHP
RHWFEEDYVGCIHVYKVEGYNRRSLIRKLAQVVKSSRRGG
Download sequence
Identical sequences WP_066795008.1.88009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]