SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_068666833.1.96079 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_068666833.1.96079
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 3.53e-61
Family Archaeal IMP cyclohydrolase PurO 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_068666833.1.96079
Sequence length 196
Comment IMP cyclohydrolase [Thermococcus piezophilus]; AA=GCF_001647085.1; RF=representative genome; TAX=1712654; STAX=1712654; NAME=Thermococcus piezophilus; strain=CDGS; AL=Complete Genome; RT=Major
Sequence
MRYVGRMLGVGLNNGRPFAFYRLNSRSFPNRRAVIRGNEIYIANQTETDNPYVSYPVVKL
LENYAVVSNGLQTVFMAQALEEESPRKALIHVLDALDYERDDYSTPRIAVIVECGKARGW
LGFVGREELWVKAIKLEEGKALFTATYNVDGIEELELSFSNAEELAEKVLRLEFSHPVLA
IAVVEKEGGWKAAVKP
Download sequence
Identical sequences A0A172WIT1
WP_068666833.1.96079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]