SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_069807131.1.20533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_069807131.1.20533
Domain Number 1 Region: 91-176
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.57e-21
Family tRNA-intron endonuclease catalytic domain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.00000000000000373
Family tRNA-intron endonuclease N-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_069807131.1.20533
Sequence length 185
Comment tRNA-intron lyase [Vulcanisaeta thermophila]; AA=GCF_001748385.1; RF=representative genome; TAX=867917; STAX=867917; NAME=Vulcanisaeta thermophila; strain=CBA1501; AL=Contig; RT=Major
Sequence
MAFKGYLVGNAVVIPSIEDSRKLYSMGFYGKFLGRDKVRINEVNSVNTPLILSIVEALYL
VDKGLLRVFTTDGKPLGRDDLVMVGRESIANFDNVYAIYRELRDGGFIIKSGLKFGSLFA
VYEKGPGIDHAPVLLHFVEPRRAVTALDITRAARLSHSVNKRFVMATYNEADGRIHYVAF
EWWVP
Download sequence
Identical sequences WP_069807131.1.20533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]