SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_070136456.1.58527 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_070136456.1.58527
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 3.14e-57
Family PA2201 N-terminal domain-like 0.000000433
Further Details:      
 
Domain Number 2 Region: 124-278
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 5.23e-44
Family PA2201 C-terminal domain-like 0.0000000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_070136456.1.58527
Sequence length 281
Comment hypothetical protein [Pseudomonas aeruginosa]; AA=GCF_001756425.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=9AR3; AL=Scaffold; RT=Major
Sequence
MALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQPFAAQGHAALENA
WAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGAARDSLREQGEVDF
ETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRLLDYLGAAALGLTS
ASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKAQKKTRRLSGPYAW
GWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGDA
Download sequence
Identical sequences WP_070136456.1.58527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]