SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_070877435.1.18718 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_070877435.1.18718
Domain Number 1 Region: 19-73
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.000000000000197
Family Insect phospholipase A2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_070877435.1.18718
Sequence length 94
Comment phospholipase [Bacillus sp. HMSC76G11]; AA=GCF_001838545.1; RF=na; TAX=1608910; STAX=1608910; NAME=Bacillus sp. HMSC76G11; strain=HMSC76G11; AL=Scaffold; RT=Major
Sequence
MSGRKNRKRRARCIFPEYRWCGPGCSGPGLPINDVDACCRRHDLCLDRGISSCECDYAFI
ECLRPKINNQTQKGRNAALMYKVMKLKTLFTCGQ
Download sequence
Identical sequences A0A1S1FL75
WP_070877435.1.18718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]