SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_072562256.1.51233 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_072562256.1.51233
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily SRP19 9.55e-26
Family SRP19 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_072562256.1.51233
Sequence length 95
Comment signal recognition particle protein Srp19 [Methanohalophilus halophilus]; AA=GCF_001889405.1; RF=representative genome; TAX=2177; STAX=2177; NAME=Methanohalophilus halophilus; strain=Z-7982; AL=Complete Genome; RT=Major
Sequence
MKDEGRLVIWPASIDRSKSRNEGRIISRKSSVKEPNLEEMEKAAASLDLNPEVQKDKAYP
RSWWEKSGRILVDKNESRTTTARQISKTIKKVRQG
Download sequence
Identical sequences A0A1L3Q504
WP_072562256.1.51233 WP_072562256.1.52505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]