SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_074830430.1.84483 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_074830430.1.84483
Domain Number 1 Region: 15-200
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 2.35e-22
Family Archaeal IMP cyclohydrolase PurO 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_074830430.1.84483
Sequence length 238
Comment inosine monophosphate cyclohydrolase [Ruminococcus albus]; AA=GCF_900112155.1; RF=na; TAX=1264; STAX=1264; NAME=Ruminococcus albus; strain=AR67; AL=Scaffold; RT=Major
Sequence
MKTLDIYEELKGNAYPGRGIVIGKSADGKHAVTAYFIMGRSVNSRNRVFTETEDGIKTEA
ADPSKLSDPHLIIYSPVRVLGNKTIVTNGDQTDTIYELMDKQQTFEQSLRTREYEDDAPN
YTPRISGIMHVGDGQYNYAMSILKSADGNPDSVERFTFTYSTPIAGFGHFIHTYMGDGNP
LPSFEGEPKKVTIPNDIDEFTNGLWNALNEDNKVSLFVRFIDIETGKAVSKIVNKYSK
Download sequence
Identical sequences A0A1I1DIJ6
WP_074830430.1.72734 WP_074830430.1.84483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]