SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_074895913.1.30509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_074895913.1.30509
Domain Number 1 Region: 14-71
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.0000000000695
Family Insect phospholipase A2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_074895913.1.30509
Sequence length 93
Comment hypothetical protein [Bacillus megaterium]; AA=GCF_900113355.1; RF=na; TAX=1404; STAX=1404; NAME=Bacillus megaterium; strain=ATCC 14581; AL=Scaffold; RT=Major
Sequence
MSVPNKRKATPCLFPGYKWCGPGCSGPGCPVNDVDCCCKYHDLCYEDYGSCRSCDEQFLD
CLCSKANPYSLKGRQAYVMYTYMRLKLALKQYD
Download sequence
Identical sequences WP_074895913.1.30509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]