SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_078407121.1.12946 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_078407121.1.12946
Domain Number 1 Region: 44-180
Classification Level Classification E-value
Superfamily PHM/PNGase F 5.23e-89
Family Glycosyl-asparaginase 0.0000000713
Further Details:      
 
Domain Number 2 Region: 181-353
Classification Level Classification E-value
Superfamily PHM/PNGase F 1.57e-61
Family Glycosyl-asparaginase 0.00000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_078407121.1.12946
Sequence length 354
Comment peptidase [Elizabethkingia endophytica]; AA=GCF_002022045.1; RF=na; TAX=1606016; STAX=1606016; NAME=Elizabethkingia endophytica; strain=JM-87; AL=Complete Genome; RT=Major
Sequence
MRKLLIFSISAYLMAGIVSCKGVDSATPVTEDRLALNAVNAPADNTVNIKTFDKVKNAFG
DGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGR
FITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDY
KYSAVVPVVQYNKSSIDGVPYGKAHTLALKKNIQLPTNTEKAYLRTTISGWGHAKPYDAG
SRGCAEWCFRTHTIAINNSNTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTR
IDVLNNSLIGSTFSYEYKFQNWTNNGTNGDAFYAISSFVIAKSNTPISAPIVTN
Download sequence
Identical sequences WP_078407121.1.12946 WP_078407121.1.21739 WP_078407121.1.50231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]