SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_081755479.1.101303 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_081755479.1.101303
Domain Number 1 Region: 46-71
Classification Level Classification E-value
Superfamily Fibritin 0.0000216
Family Fibritin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_081755479.1.101303
Sequence length 140
Comment hypothetical protein [Xylella taiwanensis]; AA=GCF_000576405.1; RF=representative genome; TAX=1444770; STAX=1444770; NAME=Xylella taiwanensis; strain=PLS229; AL=Contig; RT=Major
Sequence
MSLHGGDAGVQAPPALQFHQGDGTHLQARPASGGSKTITLPNASGDLIIDAPSDRQRYVR
QDGGWVAIETEPAPASDPLPDAVRARRDLLLKNSNHYMLLDVPLSEAKRTAWMQYRTALR
QITSQPGFPSQVTWPAAPHP
Download sequence
Identical sequences WP_081755479.1.101303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]