SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_082673306.1.5789 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_082673306.1.5789
Domain Number 1 Region: 13-173
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 2.48e-24
Family Archaeal IMP cyclohydrolase PurO 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_082673306.1.5789
Sequence length 213
Comment inosine monophosphate cyclohydrolase [Eggerthellaceae bacterium AT8]; AA=GCF_001486445.1; RF=na; TAX=1720315; STAX=1720315; NAME=Eggerthellaceae bacterium AT8; strain=AT8; AL=Scaffold; RT=Major
Sequence
MQDLAAILRTNPYPGRGIVVGHDRVYYWIMGRSANSRNRVFVPTDDGIRTEAHDPALLED
PSLIIYHPVRTMGDALVVTNGDQTDTIVEAGCFHKGCKQRRFEPDAPNFTPRISAIVRPD
GSFQISILKHAEGPADRCTREFFAYEGVDEGQGYFISTYQGDGNPLPSFAGEPQLVTVPD
PAAVWDALNPDNKVSLYVNVAGDVTLFNKNLGD
Download sequence
Identical sequences WP_082673306.1.5789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]