SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_089731113.1.61047 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_089731113.1.61047
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.49e-70
Family Archaeal IMP cyclohydrolase PurO 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_089731113.1.61047
Sequence length 191
Comment IMP cyclohydrolase [Haloarchaeobius iranensis]; AA=GCF_900103505.1; RF=representative genome; TAX=996166; STAX=996166; NAME=Haloarchaeobius iranensis; strain=EB21,IBRC-M 10013,KCTC 4048; AL=Scaffold; RT=Major
Sequence
MYIGRFLVVGPDVGAYRVSSRSFPNRTISRRDDDTLTVGPTADAPETDNPYVAYNCVRVT
DAGAVLGNGSHVDPVAEKLAMGYPARDALATALLSLDYEKDDYDTPRIAGVIGDENAFVG
IVRRDALLVRAVDEPTLVATYEMDTPEAYTLDATDAEAAAREVLDAEFEHAVCAAGLVRD
GDGFALASLDA
Download sequence
Identical sequences A0A1G9SFN7
WP_089731113.1.61047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]