SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_090694592.1.84686 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_090694592.1.84686
Domain Number 1 Region: 88-128
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000116
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_090694592.1.84686
Sequence length 131
Comment hypothetical protein [Nitrosomonas sp. Nm34]; AA=GCF_900113925.1; RF=na; TAX=1881055; STAX=1881055; NAME=Nitrosomonas sp. Nm34; strain=Nm34; AL=Contig; RT=Major
Sequence
MSLCAEAGFSATPEKFSDFIQRLNAIHPPSGTFYNVELTKACEPIDVINQPQSCGGIQGK
QCASTQQYCDFGIGHCKIADAEGTCKEKPTICTRQYEPVCGCNGITYGNACEAAAAGASI
DHVGECNPSQP
Download sequence
Identical sequences WP_090694592.1.84686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]