SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_092900750.1.6056 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092900750.1.6056
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.23e-66
Family Archaeal IMP cyclohydrolase PurO 0.00000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_092900750.1.6056
Sequence length 196
Comment IMP cyclohydrolase [Halostagnicola kamekurae]; AA=GCF_900116205.1; RF=representative genome; TAX=619731; STAX=619731; NAME=Halostagnicola kamekurae; strain=DSM 22427; AL=Contig; RT=Major
Sequence
MYVGRFVVVGPDVGAYRVSSRSFPNRKITARETALTVGPTDDAPETDNPYVAYNCLRVVE
TPTGETAAFGNGSHVDPIAEKLERGYPARDALATSLLALDYEKDDYNTPRIAATIGDDGE
ALIATVRKDALRVESVEEPTLVATYETNAPEPFAFEAASAEEAASEAYDLEFEHAVCAAG
VARTDDGFETAIENGE
Download sequence
Identical sequences A0A1I6P6W7
WP_092900750.1.6056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]