SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_092922226.1.83419 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092922226.1.83419
Domain Number 1 Region: 172-257
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.14e-21
Family eIF-2-alpha, C-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 83-171
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 3.4e-21
Family eIF2alpha middle domain-like 0.0052
Further Details:      
 
Domain Number 3 Region: 8-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.86e-20
Family Cold shock DNA-binding domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_092922226.1.83419
Sequence length 266
Comment translation initiation factor IF-2 subunit alpha [Halorubrum sodomense]; AA=GCF_900111935.1; RF=representative genome; TAX=35743; STAX=35743; NAME=Halorubrum sodomense; strain=RD 26; AL=Scaffold; RT=Major
Sequence
MKYSGWPEPGELVVGEVDEIADFGVFVDLEEYEDKRGLCHISEVASGWIKNVRDHVREGQ
TVVAKVLEIDESSNQIDLSIKDVNEHQRKETIQDWKNAQKADNWMLIALGEDVDDDRYAT
VANALLAEYESLYDAFEAAAISGNEALDDVDVDEEAAAAIVQAARNNVSVPYVDVTGYVD
LESAAPDGVDDVRDALAAAEGNGEIPDGVELDVGYVGSPEYRIKVRAPDYKLAEAQLESA
AERARESIEAAGGVGEFHRERREDDE
Download sequence
Identical sequences A0A1I6H1S2
WP_092922226.1.83419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]