SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_093030774.1.64216 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_093030774.1.64216
Domain Number 1 Region: 39-90
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000112
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_093030774.1.64216
Sequence length 93
Comment proteinase inhibitor I4 serpin [Thiocapsa roseopersicina]; AA=GCF_900106925.1; RF=na; TAX=1058; STAX=1058; NAME=Thiocapsa roseopersicina; strain=DSM 217; AL=Contig; RT=Major
Sequence
MRAVGLCRLCVPVLVILMAGLAGCGGAPTGGGSDELPVGCLVKPDPGPCRSNQLGFYYDY
RDDRCKAFTYGGCAGRVPFPTLQHCLDFCGAKR
Download sequence
Identical sequences A0A1H2VUD5
WP_093030774.1.64216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]