SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001101126.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001101126.1.72884
Domain Number 1 Region: 422-578
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-26
Family SPRY domain 0.0094
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 9.9e-17
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 172-234
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001101126.1.72884
Sequence length 640
Comment PREDICTED: tripartite motif-containing protein 47 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MDSSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPGPAPAPAPEPSVPSAPPSAPEPSAPCAPE
PWSAGEEPVRCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLE
ESLCPRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQPKVLSAVEDR
MDELGAGIAQSRRTVALIKSAAVAERERVSRLFAEAAAALQGFQTQVLAFIEEGEAAMLG
RSQGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEEGCGPGPGPPRELS
FTKSSQAVRAVRDVLAVACANQWEQLRGPGGNEDGPQKLDSEADAEPQDPDSTNLLESEA
PRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGALD
RGTYYWEVEIIEGWVSVGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEA
PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGVPASPIDPFQSRLD
SHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences A0A2K5WZK5 F7HF49
ENSMMUP00000012279 ENSMMUP00000012279 XP_001101126.1.72884 XP_005585058.1.63531 9544.ENSMMUP00000012279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]