SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001123351.2.77095 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001123351.2.77095
Domain Number 1 Region: 73-162
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.83e-20
Family Transducin (alpha subunit), insertion domain 0.0001
Further Details:      
 
Domain Number 2 Region: 23-86
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000521
Family G proteins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001123351.2.77095
Sequence length 173
Comment PREDICTED: guanine nucleotide-binding protein subunit alpha homolog, partial [Apis mellifera]; AA=GCF_000002195.4; RF=representative genome; TAX=7460; STAX=7460; NAME=Apis mellifera; strain=DH4; AL=Chromosome; RT=Major
Sequence
MAGSLTWSCTCCLRFKFSPEEIEQRYKSQEIDRMLEKDRQTFRRQVKLLLLGAGESGKST
FLKQMRIIHGIKFEPELIKEYQHVIYQNIIKGMKVLVDARDKLNIPWENAKNYDIGYQLL
KFENTMVLDARLFLHYVPALQSLWKDASIKKAFDRRREFQLVRYIFLINMFLC
Download sequence
Identical sequences XP_001123351.2.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]