SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001304726.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001304726.1.43485
Domain Number - Region: 13-37
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0915
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001304726.1.43485
Sequence length 79
Comment hypothetical protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MTQTSHMDKTQGVIDVEALKKEIREQILSELNEQKQEQKPERPKRKLSEKQLAALAAGRQ
KNPRLLAKKAREEAKAKKE
Download sequence
Identical sequences A2FTH8
XP_001304726.1.43485 gi|121886198|gb|EAX91796.1| gi|123415622|ref|XP_001304726.1| 86245.m00055 5722.A2FTH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]