SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001305773.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001305773.1.43485
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-21
Family Bromodomain 0.001
Further Details:      
 
Weak hits

Sequence:  XP_001305773.1.43485
Domain Number - Region: 93-176
Classification Level Classification E-value
Superfamily Ferritin-like 0.0223
Family Ferritin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001305773.1.43485
Sequence length 222
Comment Bromodomain containing protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MEEENWSKCFEIMKNLLEAPCTGPFRLIKEETIPHYTELIKNPQDLYRIYHRLEKREYQS
TKRWKEEVNLVWDNAIKFNGENDYGKLAHYAKLYFKKLYDEKFARIEKIAERAAELERKI
DSLLSDPPRNFPALRTLFSLKPKSETRQNDLINEIFHNIIRFTDADSQRKMFTLLRMYNP
ELGDNPIVSEKNPDLRVTVSLDSLPIKTLEALKEFISNNMSQ
Download sequence
Identical sequences A2FQI2
5722.A2FQI2 XP_001305773.1.43485 92858.m00063 gi|121887311|gb|EAX92843.1| gi|123420518|ref|XP_001305773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]