SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001315132.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001315132.1.43485
Domain Number 1 Region: 121-228
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000143
Family Ankyrin repeat 0.025
Further Details:      
 
Weak hits

Sequence:  XP_001315132.1.43485
Domain Number - Region: 77-118
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.052
Family PB1 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001315132.1.43485
Sequence length 240
Comment hypothetical protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MSYEYLNKYDDFINTYDMLYHLQPNHSIDEFFQQIQTILIEKYKVQVDQIIRNLVNACKW
NYRSIDSYIKILNMLFTKYSQKTQDIKKIFRFGINNDMKYKSNDDEICVIESDANYDEID
LIIMNDQIDKFKEFLIGKSPEDIKIYTSDFSLDVLEACAYFGSVNIFIYLISELKYQITY
ECQQFAVIGRNTDIINECIKNQYIHNQSLEYAILSHNNDFIEDIIRKNLIDFKFFKDGHS
Download sequence
Identical sequences A2EWS9
5722.A2EWS9 XP_001315132.1.43485 85938.m00094 gi|121897799|gb|EAY02909.1| gi|123454763|ref|XP_001315132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]