SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001325194.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001325194.1.43485
Domain Number 1 Region: 175-299
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.14e-17
Family Cofilin-like 0.0024
Further Details:      
 
Domain Number 2 Region: 2-137
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.00000000000000387
Family Cofilin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001325194.1.43485
Sequence length 320
Comment hypothetical protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MSCTANVDIPPETEQALADFKVNESVRGLKLLIQDEKLVIGQRVDVTGTVEQDFDGIVDY
LEKSEPAFFIVRLEKTSAHGEFVILVYIPISCPIRPRTIFASSRVPVQRYISRVFTGITD
YFFDDLKDCNYKDFAKQMKKDDAALSFDERRQKEQAAQNAVAQIQLPEHDSFTWECDADL
LEALKKLAAKEGPHFVAGMGDLQGNGVKFAGTGESIEDLKADAPRYVAIRYDDNGEEKLY
FLLYCPDTAKPREKMMSSTCKASFIKGCKDCGIEFVQNLEIRDKDEFNDTNLDKLIHPPE
DDHQYGEVNIIRKPRRPGRR
Download sequence
Identical sequences A2E335
94232.m00180 5722.A2E335 XP_001325194.1.43485 gi|121908089|gb|EAY12971.1| gi|123488551|ref|XP_001325194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]