SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001347382.1.26446 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001347382.1.26446
Domain Number 1 Region: 8-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000181
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001347382.1.26446
Sequence length 213
Comment mitochondrial ribosomal protein L22/L43, putative [Plasmodium falciparum 3D7]; AA=GCF_000002765.3; RF=representative genome; TAX=36329; STAX=5833; NAME=Plasmodium falciparum 3D7; AL=Chromosome; RT=Major
Sequence
MCSNGVYQLKNILLRYSETGHSSRNVRFFLRYLLPEYKEENKHLNFEIHHEQYEEPKVIF
EYINNTKYEISLKDIKSKHIVDIINLYKDSAGNNDYLKHGGPKVYSNRRSIQGLWCPNIY
SELNAISYLKKKKKNNIKLPKYTRESLNLNHDVIKGYGRWGNENLFPKGFDQRYLKNIFC
FPFKDSLPKKMEQNNAVESKEAEINSFYKFYKN
Download sequence
Identical sequences A0A024V727 A0A024W8F6 A0A024X776 A0A0L0D3G9 A0A0L1IDS9 A0A0L7KDD2 A0A0L7M279 A0A2I0BQG8 Q8IJU5 W4IHZ2 W4J2S7 W7F759 W7G5J0
5833.PF10_0097-1 PF10_0097 gi|124802149|ref|XP_001347382.1| gi|23494961|gb|AAN35295.1| PFHG_02668T0 PFDG_02827T0 XP_001347382.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]