SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001351113.1.26446 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001351113.1.26446
Domain Number 1 Region: 341-394
Classification Level Classification E-value
Superfamily RING/U-box 7.32e-16
Family RING finger domain, C3HC4 0.0012
Further Details:      
 
Domain Number 2 Region: 261-329
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000068
Family RING finger domain, C3HC4 0.045
Further Details:      
 
Domain Number 3 Region: 186-272
Classification Level Classification E-value
Superfamily RING/U-box 0.000000353
Family RING finger domain, C3HC4 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001351113.1.26446
Sequence length 593
Comment IBR domain protein, putative [Plasmodium falciparum 3D7]; AA=GCF_000002765.3; RF=representative genome; TAX=36329; STAX=5833; NAME=Plasmodium falciparum 3D7; AL=Chromosome; RT=Major
Sequence
MNIPKEQNKNDQINVTIEYGKDKKMKVIKTPINDTKKNNIINHNYDYSNINDKYNNTSDC
YLMNNEDGINLYLNYYKKNFLKFQENNLYNVYELKDIEKKMELAILEIMNLINIQYDYAY
HFLKAYNFNSNDLLENWFNNSKKVLTKLKLSHLKEEDILNNNNNNNIDEPMIKQKKEQFV
HNCKQEKFICPILFLECDIEDTYTLSCGHKYSKECLKNYLKTSLHNDFEDDIITKECIDL
KCNKIIKKNDWKNICEEKDYEKYLYTLLHIYIKKSKDLKKCPNKPCPYIIQSVMLNNNNV
ICKCGYHFCFECLHEFHRPLLCSYIKKWYELENNDDHNMKWIHAYTKMCPNCNKPIEKNS
GCMNVKCICGYSFCWLCLDNWKNHKGGFYKCNKYLEHNSKYNEQKKQKKKTDKKKDDTVK
TYDDEKEDTDKTHDNDNIQNNREEKRNSHLILNRYNHFKSRFNDHQYAENFSIHTQLLFL
YNFCKNYNIHLHKMKFFEDAIIQIIKCRKILKWSYTYAYFSNWKSDNQKHLFEYHQGELE
KNLDILQTKTEDINLTQFKNNTDNDTVRDIQQITQMIDIFFKNICEFMENNFV
Download sequence
Identical sequences A0A024VGE6 A0A024WD39 A0A024WXK4 A0A024XEY4 A0A0L1I2Y5 O97226 W4IRC2 W7KAR3
XP_001351113.1.26446 5833.PFC0175w-1 gi|124504741|ref|XP_001351113.1| gi|4493881|emb|CAB38990.1| PFC0175w

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]