SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001372399.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001372399.2.35504
Domain Number 1 Region: 79-211
Classification Level Classification E-value
Superfamily Second domain of FERM 3.14e-16
Family Second domain of FERM 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001372399.2.35504
Sequence length 268
Comment PREDICTED: tyrosine-protein kinase JAK1-like, partial [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
ISPLCHNLFALYDEKTKLWYAPNHRIHIEDKTSLRLHYRMRFYFTNWHGTNENEQSVWRH
SPKKQKNGYERRRVLDGTPLLDAHSLEYLFAQGQYDLVKCLAPVRDPKTDQEVHEIENEC
LGMAVLAISHYAMMKSIQLPDLPKDVSYKRYIPETLNRTIRQRNLLTRMRINNVFKDFLK
EFNNKTICDSSVTPHDLKVKYLSTLETLTKHYGAEIFETSLLLISSENEMNKFISKDCGE
VIRYEVMVTGNLGIQWRQKPNVSMSVNG
Download sequence
Identical sequences XP_001372399.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]