SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001379952.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001379952.2.35504
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.53e-39
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 488-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 393-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 590-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-18
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 230-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000209
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 
Domain Number 6 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000149
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001379952.2.35504
Sequence length 667
Comment PREDICTED: zinc finger protein 202 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MTTMLEPEDQDLWEEEGIFLVKLEDDSTWRQDPVLQKDDAVLETSHQNFRRFRYQEASGP
REALSRLRELCHQWLRPERRTKEQILDLLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETSNLGADSESPIEQPEPVHTLSLEESHEEGPQ
SPDLSVEEQSPCHEEEPQPLQESELPVPQDHVLPEERSGGDQEMVNLLTAISQGLATFKD
VTLSFSQEQWGDLDPTQKEFYGEYVLQEDCGIVVSLTFPIPRLEEISQVEEEEESWVPDL
EYPQDPEETEILSFTYTGDRSEDEEFLEQEVNIEDVQRTILGSPEIPQNIDLELLFEDEP
SSPSERRLSTSFSPTHNFTSLQENLQFHPLLGRPHECPVCRKTFSCNSHLIRHLRTHTGE
KPYKCSDCGKSYTRSSHLVRHQKIHKLQGPFTFPHNRDRFDEISQSLQHEIIPQTEKPYR
CETCGKHFRWTSDLVRHRRTHTGEKPFFCSICGKSFSQKSVLTTHQRIHLGGKPYLCGEC
GEDFTDHRRYLAHRKTHSSEELFLCNECGRGFSHSAAFAKHLRGHASVRSCRCSECGKSF
SRRDHLVRHQRTHTGEKPYTCPTCGKSFGRGYHLIRHQRTHSEKTLSQDPSTEKAEFRKD
SQTEDGL
Download sequence
Identical sequences F7GC31
XP_001379952.2.35504 ENSMODP00000016175 ENSMODP00000016175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]