SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001452389.1.48737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001452389.1.48737
Domain Number - Region: 35-69
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00228
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001452389.1.48737
Sequence length 83
Comment hypothetical protein (macronuclear) [Paramecium tetraurelia strain d4-2]; AA=GCF_000165425.1; RF=representative genome; TAX=5888; STAX=5888; NAME=Paramecium tetraurelia; strain=Stock d4-2; AL=Scaffold; RT=Major
Sequence
MSQEHDLDDIAEQQLAEQTALSQIPSIPDQALPTRQYLEKAVIDQLHDALKALARERPKN
PIEFFSYYLLTQHCNKKQELQEQ
Download sequence
Identical sequences A0DPM5
GSPATP00019174001 XP_001452389.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]