SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001456533.1.48737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001456533.1.48737
Domain Number 1 Region: 9-112
Classification Level Classification E-value
Superfamily SRP19 1.22e-25
Family SRP19 0.0019
Further Details:      
 
Weak hits

Sequence:  XP_001456533.1.48737
Domain Number - Region: 105-142
Classification Level Classification E-value
Superfamily t-snare proteins 0.029
Family t-snare proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001456533.1.48737
Sequence length 147
Comment hypothetical protein (macronuclear) [Paramecium tetraurelia strain d4-2]; AA=GCF_000165425.1; RF=representative genome; TAX=5888; STAX=5888; NAME=Paramecium tetraurelia; strain=Stock d4-2; AL=Scaffold; RT=Major
Sequence
MQTPEQIKVESKTWKTIYPPYIDSTLTAAQGRRLGKINCVPYPQLMEISQCLSSLGLRHV
IDQHAGFPRDIFKQGRIKVRLYAEDKKPYNPQVKCKHTLLQSIAKLIKSIPNRKVEVPPY
INQMEIEKQNKPAQKKQTSNKKKHKNG
Download sequence
Identical sequences A0E1G9
XP_001456533.1.48737 GSPATP00022305001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]