SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001456568.1.48737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001456568.1.48737
Domain Number 1 Region: 244-370,401-452
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.81e-26
Family Nucleotide and nucleoside kinases 0.00069
Further Details:      
 
Domain Number 2 Region: 54-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000712
Family Nucleotide and nucleoside kinases 0.0026
Further Details:      
 
Domain Number 3 Region: 11-53
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0069
Further Details:      
 
Domain Number 4 Region: 184-272
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000177
Family Extended AAA-ATPase domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001456568.1.48737
Sequence length 453
Comment hypothetical protein (macronuclear) [Paramecium tetraurelia strain d4-2]; AA=GCF_000165425.1; RF=representative genome; TAX=5888; STAX=5888; NAME=Paramecium tetraurelia; strain=Stock d4-2; AL=Scaffold; RT=Major
Sequence
MDQANKLQYQQQVENYLERNKVYHIFEDLLKSLIIKKPDDPIQFLINKLQEPETKKIFVV
GPPGSKLRELSLTLADYLNFHIVSIGDLIEKELSKKSELSQQIQDSLDKFQYVSDEIVIN
IALNQINHLENEKKSYIFEGFPKTRVQGLALQKEGIIPDAFLILEMSQEKVYQCCLKKLD
SEQFNKLNNKEDLVKNHSLEYQLNLKQVKEVYKNQYFSVDGEKNYELEDMAQLLKYKLYD
NSPKRALRIVVIGPPGSGRSTLAKKLSSKYGFVYISTRELISNLVNQKGATGKEAFEKVS
KGDFVDDRIVNALIKERLNQTDCQLQGYVLDGYPKTDKQLESLNELNVQPTLMVIIDAAD
DIVTRRLVQRRTDPITGKMYNSVDEADKEVRSRLVIAPNEKREVVQQRLKRWDDLKQLID
STPKYASIIYKVSGENPLDNMIESVCYHLEKMN
Download sequence
Identical sequences A0E1K4
XP_001456568.1.48737 GSPATP00022341001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]