SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001503781.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001503781.1.31192
Domain Number - Region: 109-148
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0196
Family Rad50 coiled-coil Zn hook 0.0086
Further Details:      
 
Domain Number - Region: 176-205
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0628
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001503781.1.31192
Sequence length 364
Comment PREDICTED: proline-rich protein 11 [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MPKFKQRRRKLKAKAKRLFKKKEACHSQSKLITPLPPPPSPERVVIPSTDTPLSKSWLRA
SWNFKCPNIKDAVKLWANRVWSIYNWCQNCMSQSLEVLKDTIFPSHFCRREIHSLKQRFR
TLESELCKLQEALKTVSENSFCPSCGQTCHMSGKLTDVPVCALNTPGESGAELPPTLPQP
VIHLPPPPPPPPPPPPPLPLPPPPIAPLLLRKSNLTKELQVGPLKKDGPMQITVKDLLTV
KLKKTQSFDEKRKHVPSPKARNPLVTVSDLKHVTLKPSSKVLTQVTNVFITPGKSQIDLR
KLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTRALRRKFELAHPRSPTQTLPLSTSSF
DEQN
Download sequence
Identical sequences F7CWH1
XP_001503781.1.31192 ENSECAP00000012681 9796.ENSECAP00000012681 ENSECAP00000012681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]