SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001516968.1.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001516968.1.37387
Domain Number 1 Region: 14-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.15e-34
Family PB1 domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 130-249
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-22
Family PDZ domain 0.00000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001516968.1.37387
Sequence length 349
Comment PREDICTED: partitioning defective 6 homolog alpha isoform X1 [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
MAKLQRTPARSADNIIEVKSKFDAEFRRFALPRASVGGFQEFSRLLRAVHQIPGLDVLLG
YTDVHGDLLPITNDDNLHRALASAHPLLRLLVQKRADADPVGTVFTSNSLQRRRKGLLRP
AVPPRARPPLLIGLPQDFRQVSSVIDVDLLPESHRRVRLHKHGSGRPLGFYIRDGVSVRV
APQGLEKVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIDVAGKSLDQVTDMMVANSHN
LIITVKPANQRNNVVRGAGRPSTSAALPAPPAPEADSDEDSDLVVENHPPPRYFSPCLNG
APPPPPHWDLRPSRSLPGSRGSLHSLDSQEGAGPGRGGSLREDGTGLTL
Download sequence
Identical sequences XP_001516968.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]