SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001520079.3.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001520079.3.37387
Domain Number 1 Region: 72-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000694
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 2 Region: 110-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000034
Family LDL receptor-like module 0.00044
Further Details:      
 
Domain Number 3 Region: 29-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 4 Region: 156-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 5 Region: 2-26
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001520079.3.37387
Sequence length 207
Comment PREDICTED: very low-density lipoprotein receptor-like, partial [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
RGRCISKNFVCNGHDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPSSWVCDNDPDCSDQS
DESLERCGRQPAPHAKCPSSEIQCDSGECIHKKWRCDGDPDCKDGSDEINCPSRTCRPDQ
FKCEDGNCIHGSRQCNGVRDCVDGSDEVNCKNANQCSGPGKFKCRSGECIDISKVCNQQQ
DCKDWSDEPLKECNINECLLNNGGCSH
Download sequence
Identical sequences XP_001520079.3.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]