SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001625394.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001625394.1.94760
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 143-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000275
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 200-258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000106
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 4 Region: 88-144
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000128
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001625394.1.94760
Sequence length 258
Comment predicted protein, partial [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
FTRTPQDTAIDLGSVLLWHCTATGYPTPVLTWQKNGQGFNPWWPPHIRILANNSLLINGV
KREDAGSYQCRATINSLSNAIQAVLIVRVPGGWSAWQSWTPCTQSCGTGLRYRYRACDNP
FPAHGGATCPGSNEDRERCSAQPCPVPGGWSAWQSWTPCTQSCGTGLRYRYRACDNPFPA
HGGATCPGSNEDRERCSAQPCPVDGKWSTWADWTVCSRSCGGGVQYRTRTCTSPPPSDGG
RECLGDETVSSVCQTQKC
Download sequence
Identical sequences A7SSL1
jgi|Nemve1|12396|gw.273.23.1 XP_001625394.1.94760 45351.JGI12396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]