SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001633303.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001633303.1.94760
Domain Number - Region: 173-224
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0288
Family Supernatant protein factor (SPF), C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001633303.1.94760
Sequence length 330
Comment predicted protein [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
MYGNLGSGFITSFWWVRLVSCARGEYVVSEAAAAQKMRIQVLDTANHILYKNDDARKGKF
AITTSENNYYEVCFKDNSPGQGAVRREVSINIKHGTEAKAYQNLAQAEKLKPIKLAMRRL
EDMADEIVSSFAYFREREEEQRNTNSFKIKAATRKCLTDFAQKDQLFKADYEISHDQSST
VKITVIDIDVTLQLLFTKENATKGKFAFTFDRDGHFDLCFDNQVRLGSGSDSIVFLKIKR
GSEAKNYENLALAQKLQPQEIEVMRLADMSSEVLTSLGRLINRGEDHLITNESTGARILY
LGVFLTMLLVMLTGGQLVYLHRFFAAKKLI
Download sequence
Identical sequences A7S4Z4
XP_001633303.1.94760 45351.JGI242897 jgi|Nemve1|242897|estExt_fgenesh1_pg.C_740081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]