SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001637658.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001637658.1.94760
Domain Number 1 Region: 16-52
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 89-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 52-86
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001637658.1.94760
Sequence length 131
Comment predicted protein [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
MFFFFTKFFQGFRCPDKSTQFQCVNGQCVSRDLICDGDNACLDFSDEANCKCLSSKFACE
SGECIDVVGLCDGTDDCKDASDESRCDHKCSKDEYQCVSGACVKWPLTCDGKKDCEDGTD
EPAICGKYDSM
Download sequence
Identical sequences A7RSM6
45351.JGI91746 XP_001637658.1.94760 jgi|Nemve1|91746|e_gw.28.246.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]