SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001653369.1.48696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001653369.1.48696
Domain Number 1 Region: 66-91,208-385
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-50
Family G proteins 0.00000188
Further Details:      
 
Domain Number 2 Region: 95-215
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.62e-35
Family Transducin (alpha subunit), insertion domain 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001653369.1.48696
Sequence length 391
Comment guanine nucleotide-binding protein subunit alpha homolog [Aedes aegypti]; AA=GCF_002204515.2; RF=na; TAX=7159; STAX=7159; NAME=Aedes aegypti; strain=LVP_AGWG; AL=Chromosome; RT=Major
Sequence
MATVNNRRGGGTGEGTLSKLSCSRSCCGDLFGYLLRLRVSPEELEQRYKSREIDKFLEKD
KHAFRRQVKLLLLGAGESGKSTFLKQMRIIHGIKFEPELVKEYQHVIYQNIVKGMQVLCD
ARDKLDIPWENPTSQLAANQAVIFHSGILIAEQFRQYVPLIAMLWQDRAIRRAYDRRREF
QISDSVSYFLDDLDRISRLDYVPTHRDILHCRKATKGVFEFTIRIQNIPFVFVDVGGQRT
QRQKWTKCFDCSVTSILFLVSTSEFDQVLAEDRKTNRLEESRNIFDTIVNNTTFQGISII
LFLNKTDLLAQKVKNPDTDIRWYYPQFTGNPHSILDVQNFILQMFMNVRKNTKTPIYHHF
TNAVDTQNIQVVFSSVKDTILQRNLSALMLQ
Download sequence
Identical sequences Q16Y79
XP_001653369.1.48696 XP_021703771.1.48696 XP_021703772.1.48696 XP_021703773.1.48696 XP_021703774.1.48696 AAEL008630-PA 7159.AAEL008630-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]