SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001655687.1.48696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001655687.1.48696
Domain Number 1 Region: 149-215
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000942
Family Tachycitin 0.025
Further Details:      
 
Domain Number 2 Region: 93-154
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000314
Family Tachycitin 0.03
Further Details:      
 
Domain Number 3 Region: 19-81
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000915
Family Tachycitin 0.02
Further Details:      
 
Domain Number 4 Region: 213-276
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000034
Family Tachycitin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001655687.1.48696
Sequence length 289
Comment peritrophin-44 [Aedes aegypti]; AA=GCF_002204515.2; RF=na; TAX=7159; STAX=7159; NAME=Aedes aegypti; strain=LVP_AGWG; AL=Chromosome; RT=Major
Sequence
MRRIIGVALFSVIALSIVPTSEANRCAGRPDGFFINDYTACEGFFTCIRETPVPGRCPEG
FYFNENSQLCDHPWNVICLLCVREETETETEPDTNNVVTEFFPIENECRMYTLCVDGVGF
LRECSPGLMFDREAQRCDLEANVQCVESLCPNSVNPAVASMVPDPTDCSQYFICFNRVPN
GPHSCNTGLLFDPITRRCDLEENVECEVVTEPPTLTDCPASGLHYIPVEGECSNFFICLD
GDKIGEEVCADGLIFDVNLRNCRPRTDEGSQCITDPPAEVAARLFLGYN
Download sequence
Identical sequences Q17HR7
7159.AAEL002623-PA XP_001655687.1.48696 AAEL002623-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]