SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001689300.1.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001689300.1.40869
Domain Number 1 Region: 144-211
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000314
Family Tachycitin 0.03
Further Details:      
 
Domain Number 2 Region: 86-141
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000863
Family Tachycitin 0.026
Further Details:      
 
Domain Number 3 Region: 222-281
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000392
Family Antifungal peptide scarabaecin 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001689300.1.40869
Sequence length 292
Comment AGAP011614-PA [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MKTLAVIVTVAVLASAVMAVSEHVSIEEPFRRPGGGGGGGGSGGGGGGSSGGGNRPPPPV
APTPDSGNSSEDDSSDSKEDAYVNPCKGLLIGILEHPSSCYKYISCYKEVATEETCPPDT
IFDLDEITCVPGNQRTCRKEGDPYPLPTDMCRGIVLGTMVHPEDCNKYVSCLLGQARERS
CRPGFVFSERLFVCLPGDLNSCTVTLLPTTSTIAPEDIRPLPSDICRRNSVAFGVLPHPQ
FCTKYVTCTLWIPAERDCDRFKVFSERFSMCMIGDVNRCRPILGREAELEMQ
Download sequence
Identical sequences A7UVH9
AGAP011614-PA|hypothetical 7165.AGAP011614-PA AGAP011614-PA XP_001689300.1.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]