SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001691488.1.80978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001691488.1.80978
Domain Number 1 Region: 18-124
Classification Level Classification E-value
Superfamily PHM/PNGase F 0.00000000000000115
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001691488.1.80978
Sequence length 126
Comment hypothetical protein CHLREDRAFT_181567, partial [Chlamydomonas reinhardtii]; AA=GCF_000002595.1; RF=representative genome; TAX=3055; STAX=3055; NAME=Chlamydomonas reinhardtii; strain=CC-503 cw92 mt+; AL=Scaffold; RT=Major
Sequence
MAPGRLFGLLVAVALALQAYAQLPVVVSHSIEVNITVPPFKVDQDDAYICVSALLPPHPH
KLVGIIPHAKQEVVHHILLYDWLNKQLWFDQLTAAGMPVAWPEDIRDWSSIQYAVGWNFT
PEVLAK
Download sequence
Identical sequences A8JK54
XP_001691488.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]