SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001708859.1.56740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001708859.1.56740
Domain Number 1 Region: 332-453
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.28e-31
Family cAMP-binding domain 0.00061
Further Details:      
 
Domain Number 2 Region: 185-331
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-20
Family cAMP-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  XP_001708859.1.56740
Domain Number - Region: 13-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001708859.1.56740
Sequence length 460
Comment CAMP-dependent protein kinase regulatory chain [Giardia lamblia ATCC 50803]; AA=GCF_000002435.1; RF=representative genome; TAX=184922; STAX=5741; NAME=Giardia lamblia ATCC 50803; strain=WB C6; AL=Scaffold; RT=Major
Sequence
MPPKFPRPDDPVLRKYLDTKNIDNVIFDLYKQVCKDRPDDVLSYLIHKFASYSPLAAAVL
QNPDSYMGSKAKVTRFEQPLPPPMEVPSDETPIKKITPSVPFKPVVMEPTGSANSASIEN
FQLINTTDGPSVSSADHNFSIAPDYNLHLATPSEQGRGSPSNLTARQRRGRRAAIAAPAE
NREIDLPVLEKTPEETALILKALNSSALTETYSRDVKQALASVLKLIDCPMGTVLIKQGD
PGDYFYIMKTGHCNIYKTENVPPETVSVPDNTLDPAECVQKLGPQVNEVLPGVGVGDLAL
LYGAPRAATVITTVESSFWAIHGTDFRIFIRMQREAEIQRYIGFLRHVEVLKQLRENELF
ALAQACTPEYYIDGQDIVTQGDEGNTFYFIEDGRVDVIVSDHKVAELSSNSYFGEAALLN
NAPRNATCRSVGETKVAALDRESFDNLLGPLKSILERPKA
Download sequence
Identical sequences E2RU80 Q2VWB6
gi|157436973|gb|EDO81185.1| gi|159117278|ref|XP_001708859.1| XP_001708859.1.56740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]