SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001732095.1.82384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001732095.1.82384
Domain Number 1 Region: 148-251
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.24e-39
Family FAD-dependent thiol oxidase 0.0000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001732095.1.82384
Sequence length 276
Comment hypothetical protein MGL_0688 [Malassezia globosa CBS 7966]; AA=GCF_000181695.1; RF=representative genome; TAX=425265; STAX=76773; NAME=Malassezia globosa CBS 7966; strain=CBS 7966; AL=Contig; RT=Major
Sequence
MLTLTRFLRFLILATLLLLIPAFVYLSQGTSSPVRDPKTGEWIWQGMLQSIQGHGPYENN
PPQERPYHPITDWRKLLNNVMPTHPAKEHNYNNQHRPVLPPQKTDPAVPEPVRFGHTSAG
LSSVDVPAVKIEPKVDGAYAPAMTNATAKAELGRSTWRFLHTMMARFPENPTPQQSEDLR
KFIHLFSLLYPCGDCAAHFQQLLKEWPPQVGSRHNAELWLCNAHNAVNTRLHKPQFDCTK
LNETYDCGCGSTASSLLSGINPQDAKGSAHILPFYI
Download sequence
Identical sequences A8PUH6
XP_001732095.1.82384 gi|159105997|gb|EDP44881.1| gi|164661946|ref|XP_001732095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]