SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001742431.1.20067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001742431.1.20067
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-22
Family Bromodomain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001742431.1.20067
Sequence length 63
Comment hypothetical protein, partial [Monosiga brevicollis MX1]; AA=GCF_000002865.3; RF=representative genome; TAX=431895; STAX=81824; NAME=Monosiga brevicollis MX1; strain=MX1; AL=Scaffold; RT=Major
Sequence
FLKPVDTKLFTSYLTVVQHPMDLSVISRKIHDQEYNSIWEYVEDMHLMINNCLLFNPKQS
SFH
Download sequence
Identical sequences A9UQW4
jgi|Monbr1|3721|gw1.2.929.1 81824.JGI3721 XP_001742431.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]