SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001794632.1.30160 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001794632.1.30160
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 5.89e-18
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00019
Further Details:      
 
Domain Number 2 Region: 78-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000136
Family Cold shock DNA-binding domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001794632.1.30160
Sequence length 188
Comment hypothetical protein SNOG_04209 [Parastagonospora nodorum SN15]; AA=GCF_000146915.1; RF=representative genome; TAX=321614; STAX=13684; NAME=Parastagonospora nodorum SN15; strain=SN15; AL=Scaffold; RT=Major
Sequence
MFFLKELEKTIQLHPSYFGPLIRSHIHRELLQKEEGSSTGKYTIVCILDAFDISDGKVLP
GSGHAEYIVHYKAIVWRPYKGEVMDGVVTSVLRTGFFVDCGSLQAFVGRNVRMPCASCRY
PSTNTTQMIPSDITFDANATPPQWTDNGEQVIEKGTNIRIKIKGLRSEVDKMFAVGTMKE
DYLGPLPQ
Download sequence
Identical sequences Q0UVK5
XP_001794632.1.30160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]