SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001828634.2.59657 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001828634.2.59657
Domain Number 1 Region: 136-275
Classification Level Classification E-value
Superfamily ISP domain 1.93e-39
Family Rieske iron-sulfur protein (ISP) 0.00000298
Further Details:      
 
Domain Number 2 Region: 94-148
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0000000000000198
Family ISP transmembrane anchor 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001828634.2.59657
Sequence length 276
Comment ubiquinol-cytochrome c reductase iron-sulfur subunit [Coprinopsis cinerea okayama7#130]; AA=GCF_000182895.1; RF=representative genome; TAX=240176; STAX=5346; NAME=Coprinopsis cinerea okayama7#130; strain=okayama7#130; AL=Contig; RT=Major
Sequence
MASFQVVKKAVSLGPAVRALPSGVPHVPLLNLAARAPHDNHHYDPQAPRTDVAPRWVGGA
SKVGTQLLSKTVASALPTVNFQQRLMHTSAVVKNANETPDWSAYRTNPENSRALSYFMVG
SMGVISASAAKSSVSEFLQTMAASADVLALAKVEVDLASIPEGKNVIIKWRGKPVFIRHR
TQSEIEEARAIDWKSLRDPESDDARVKKPEWLVMLGVCTHLGCVPIGEAGDYGGWFCPCH
GSHYDISGRIRKGPAPTNLEVPQYELNEADNKLVIG
Download sequence
Identical sequences A8N185
CC1G_10506T0 XP_001828634.2.59657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]