SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001832983.2.59657 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001832983.2.59657
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.73e-21
Family Cofilin-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001832983.2.59657
Sequence length 98
Comment hypothetical protein CC1G_01045 [Coprinopsis cinerea okayama7#130]; AA=GCF_000182895.1; RF=representative genome; TAX=240176; STAX=5346; NAME=Coprinopsis cinerea okayama7#130; strain=okayama7#130; AL=Contig; RT=Major
Sequence
MEEVEQLDDISIEELAEELPENSPRYVVLSYELEHKDGRKSFPLVLINWAPVSSEIGLLT
LHASALLNFQNTADVSKVIEVRDGPEGLTKEIIDAKFA
Download sequence
Identical sequences A8NEC0
CC1G_01045T0 XP_001832983.2.59657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]