SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001855831.1.94360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001855831.1.94360
Domain Number 1 Region: 30-82
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 1.26e-18
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001855831.1.94360
Sequence length 87
Comment conserved hypothetical protein [Culex quinquefasciatus]; AA=GCF_000209185.1; RF=representative genome; TAX=7176; STAX=7176; NAME=Culex quinquefasciatus; strain=JHB; AL=Scaffold; RT=Major
Sequence
MKGIVILLLVIATTLALDYPRECPSAAEEDPWHPVHLPHPTDCSKFYKCFNGQKHEQVCP
AGLHWNIERDYCDYPEEAKCVRPLPDF
Download sequence
Identical sequences B0WTT4
XP_001855831.1.94360 CPIJ010670|conserved 7176.CPIJ010670-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]