SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001891597.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001891597.1.25112
Domain Number 1 Region: 98-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.53e-43
Family G proteins 0.00000128
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.54e-25
Family Transducin (alpha subunit), insertion domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001891597.1.25112
Sequence length 278
Comment Guanine nucleotide-binding protein alpha-12 subunit [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MRVLLDARQKLGYAWKNPERQKNVDSIMRFTVSDMMRGIDQSTFAEIAPLIRDFWEDASI
KQTYEQRNLFQISDSCIYFFDHINRVSMPDYCPTNRDILFCRKATRGITEHVFEIQRISF
RFIDVGGQRSQRQKWFQCFEGITSILFMVASCEYDQVILEDRRTNRVVESRSVFETIANN
KSFANVSIILFMNKSDLLEEKVPKSDIRQYFADFTGDHNSLRDVQFFLVDKFENCRRDRR
RPFFYHFTTAIDTENIRRVFKDCRETILEQNLKALMMQ
Download sequence
Identical sequences A0A0R3QZF6
XP_001891597.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]