SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001896055.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001896055.1.25112
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.11e-30
Family Cofilin-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001896055.1.25112
Sequence length 166
Comment actin-depolymerizing factor 1 [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MSSGVLVNSECQTVFQQLSEGKHHKLRYIIYKIEDKEVVVEAAVSPDELGVTDDDHDENS
KTAYEAFVQDLRERTNGFKDCRYAVFDFKFSCNRPGAGTSKMDKIVFIQLCPDGAPIKKK
MVYASSASAIKSSLGTAKILQFQVSDDSEIAHKELLSKLSEKYRDN
Download sequence
Identical sequences A0A044U7Q7 A0A0K0JMU6 A0A0N4TQA6 A0A0R3QTM7 A0A0R3RXP9 A0A182DY46 A0A1I7VR67 A0A238BV80 J9F4R2
WUBG_04621T0 OVOC6392 Bm636 LOAG_00661T0 XP_001896055.1.25112 XP_003136249.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]